RBMS3 Antikörper (Middle Region)

Produktnummer ABIN633376

Produktdetails anti-RBMS3 Antikörper

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser RBMS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RBMS3 antibody was raised against the middle region of RBMS3

Aufreinigung: Affinity purified

Immunogen: RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RBMS3 Blocking Peptide, catalog no. 33R-7382, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBMS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu RBMS3

Target: RBMS3 (RNA Binding Motif, Single Stranded Interacting Protein 3 (RBMS3))

Andere Bezeichnung: RBMS3 (RBMS3 Produkte)

Synonyme: RBMS3 antikoerper, zgc:153698 antikoerper, 6720477E09Rik antikoerper, 8430436O14Rik antikoerper, RNA binding motif single stranded interacting protein 3 antikoerper, RNA binding motif, single stranded interacting protein antikoerper, RNA binding motif, single stranded interacting protein 3 antikoerper, RBMS3 antikoerper, rbms3 antikoerper, Rbms3 antikoerper

Hintergrund: RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2.

Molekulargewicht: 46 kDa (MW of target protein)