DDX47 Antikörper
-
- Target Alle DDX47 Antikörper anzeigen
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX47 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX47 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAPEEHDSPTEASQPIVEEEETKTFKDLGVTDVLCEACDQLGWTKPTKIQ
- Top Product
- Discover our top product DDX47 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX47 Blocking Peptide, catalog no. 33R-1040, is also available for use as a blocking control in assays to test for specificity of this DDX47 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX47 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX47 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 47 (DDX47))
- Andere Bezeichnung
- DDX47 (DDX47 Produkte)
- Synonyme
- ddx47 antikoerper, DDX47 antikoerper, E4-DBP antikoerper, HQ0256 antikoerper, MSTP162 antikoerper, RRP3 antikoerper, 4930588A18Rik antikoerper, C77285 antikoerper, DEAD-box helicase 47 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 47 antikoerper, DEAD-box helicase 47 L homeolog antikoerper, DDX47 antikoerper, ddx47 antikoerper, Ddx47 antikoerper, ddx47.L antikoerper
- Hintergrund
- DDX47 is a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly.
- Molekulargewicht
- 50 kDa (MW of target protein)
-