DDX50 Antikörper
-
- Target Alle DDX50 Antikörper anzeigen
- DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX50 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX50 antibody was raised using a synthetic peptide corresponding to a region with amino acids PGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYDSDEKSETRENG
- Top Product
- Discover our top product DDX50 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX50 Blocking Peptide, catalog no. 33R-7109, is also available for use as a blocking control in assays to test for specificity of this DDX50 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX50 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX50 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 50 (DDX50))
- Andere Bezeichnung
- DDX50 (DDX50 Produkte)
- Synonyme
- GU2 antikoerper, GUB antikoerper, RH-II/GuB antikoerper, mcdrh antikoerper, 4933429B04Rik antikoerper, 8430408E17Rik antikoerper, RH-II antikoerper, DDX50 antikoerper, DDX21 antikoerper, DExD-box helicase 50 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 antikoerper, DExD-box helicase 21 antikoerper, DDX50 antikoerper, Ddx50 antikoerper, DDX21 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. DDX50 is a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing.
- Molekulargewicht
- 82 kDa (MW of target protein)
-