SRSF11 Antikörper (C-Term)

Produktnummer ABIN633352

Produktdetails anti-SRSF11 Antikörper

Target: SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SRSF11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS11 antibody was raised against the C terminal of SFRS11

Aufreinigung: Affinity purified

Immunogen: SFRS11 antibody was raised using the C terminal of SFRS11 corresponding to a region with amino acids KKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIET

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS11 Blocking Peptide, catalog no. 33R-4478, is also available for use as a blocking control in assays to test for specificity of this SFRS11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SRSF11

Target: SRSF11 (serine/arginine-Rich Splicing Factor 11 (SRSF11))

Andere Bezeichnung: SFRS11 (SRSF11 Produkte)

Synonyme: NET2 antikoerper, SFRS11 antikoerper, dJ677H15.2 antikoerper, p54 antikoerper, 0610009J05Rik antikoerper, 2610019N13Rik antikoerper, BF642805 antikoerper, Sfrs11 antikoerper, serine and arginine rich splicing factor 11 antikoerper, serine/arginine-rich splicing factor 11 antikoerper, SRSF11 antikoerper, Srsf11 antikoerper

Hintergrund: SFRS11 is 54 kDa nuclear protein that contains an arginine/serine-rich region similar to segments found in pre-mRNA splicing factors. Although the function of this protein is not yet known, structure and immunolocalization data suggest that it may play a role in pre-mRNA processing.

Molekulargewicht: 53 kDa (MW of target protein)