STRBP Antikörper (Middle Region)

Produktnummer ABIN633341

Produktdetails anti-STRBP Antikörper

Target: STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STRBP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STRBP antibody was raised against the middle region of STRBP

Aufreinigung: Affinity purified

Immunogen: STRBP antibody was raised using the middle region of STRBP corresponding to a region with amino acids PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STRBP Blocking Peptide, catalog no. 33R-7353, is also available for use as a blocking control in assays to test for specificity of this STRBP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STRBP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STRBP

Target: STRBP (Spermatid Perinuclear RNA Binding Protein (STRBP))

Andere Bezeichnung: STRBP (STRBP Produkte)

Synonyme: ILF3L antikoerper, SPNR antikoerper, p74 antikoerper, 6430510M02Rik antikoerper, AI852513 antikoerper, C230082I21Rik antikoerper, C86322 antikoerper, Spnr antikoerper, spermatid perinuclear RNA binding protein L homeolog antikoerper, spermatid perinuclear RNA binding protein antikoerper, strbp.L antikoerper, STRBP antikoerper, Strbp antikoerper

Hintergrund: STRBP contains 2 DRBM (double-stranded RNA-binding) domains and 1 DZF domain. STRBP is involved in spermatogenesis and sperm function. It plays a role in regulation of cell growth.

Molekulargewicht: 74 kDa (MW of target protein)