PSMA6 Antikörper

Produktnummer ABIN633332

Produktdetails anti-PSMA6 Antikörper

Target: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMA6 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLFKITEN

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMA6 Blocking Peptide, catalog no. 33R-2815, is also available for use as a blocking control in assays to test for specificity of this PSMA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMA6

Target: PSMA6 (Proteasome Subunit alpha 6 (PSMA6))

Andere Bezeichnung: PSMA6 (PSMA6 Produkte)

Synonyme: IOTA antikoerper, PROS27 antikoerper, p27K antikoerper, psma6 antikoerper, psma6b antikoerper, zgc:91778 antikoerper, proteasome subunit alpha 6 antikoerper, proteasome (prosome, macropain) subunit, alpha type 6 antikoerper, proteasome subunit alpha 6a antikoerper, proteasome subunit alpha 6 L homeolog antikoerper, proteasome subunit alpha 6, like antikoerper, PSMA6 antikoerper, Psma6 antikoerper, psma6a antikoerper, psma6.L antikoerper, psma6l antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. PSMA6 is a member of the peptidase T1A family, which is a 20S core alpha subunit.

Molekulargewicht: 27 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA