Nucleolar Protein 6 Antikörper
-
- Target Alle Nucleolar Protein 6 (NOL6) Antikörper anzeigen
- Nucleolar Protein 6 (NOL6)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nucleolar Protein 6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NOL6 antibody was raised using a synthetic peptide corresponding to a region with amino acids SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRETEILFHSSLLR
- Top Product
- Discover our top product NOL6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NOL6 Blocking Peptide, catalog no. 33R-8759, is also available for use as a blocking control in assays to test for specificity of this NOL6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOL6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nucleolar Protein 6 (NOL6)
- Andere Bezeichnung
- NOL6 (NOL6 Produkte)
- Synonyme
- NRAP antikoerper, UTP22 antikoerper, bA311H10.1 antikoerper, nrap antikoerper, utp22 antikoerper, AA410091 antikoerper, Nrap antikoerper, nucleolar protein 6 antikoerper, nucleolar protein 6 L homeolog antikoerper, nucleolar protein family 6 (RNA-associated) antikoerper, NOL6 antikoerper, Nol6 antikoerper, nol6.L antikoerper
- Hintergrund
- NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis.
- Molekulargewicht
- 127 kDa (MW of target protein)
-