DDX59 Antikörper

Produktnummer ABIN633308

Produktdetails anti-DDX59 Antikörper

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX59 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX59 Blocking Peptide, catalog no. 33R-7302, is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX59 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX59

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Andere Bezeichnung: DDX59 (DDX59 Produkte)

Synonyme: si:dkey-39e8.2 antikoerper, ZNHIT5 antikoerper, 1210002B07Rik antikoerper, 4833411G06Rik antikoerper, DEAD-box helicase 59 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 59 antikoerper, DEAD-box helicase 59 L homeolog antikoerper, DDX59 antikoerper, ddx59 antikoerper, ddx59.L antikoerper, Ddx59 antikoerper

Hintergrund: The specific function of DDX59 is not yet known.

Molekulargewicht: 69 kDa (MW of target protein)