DDX59 Antikörper

Produktnummer ABIN633308

Der Kaninchen Polyklonal anti-DDX59 Antikörper wird verwendet zum Nachweis von DDX59 in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für DDX59 Antikörper (ABIN633308)

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX59 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-DDX59 Antikörper

Aufreinigung: Affinity purified

Immunogen: DDX59 antibody was raised using a synthetic peptide corresponding to a region with amino acids PQKADSEPESPLNASYVYKEHPFILNLQEDQIENLKQQLGILVQGQEVTR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX59 Blocking Peptide, (ABIN5613171), is also available for use as a blocking control in assays to test for specificity of this DDX59 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX59 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX59

Target: DDX59 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 59 (DDX59))

Andere Bezeichnung: DDX59

Hintergrund: The specific function of DDX59 is not yet known.

Molekulargewicht: 69 kDa (MW of target protein)