PPP1R8 Antikörper
-
- Target Alle PPP1R8 Antikörper anzeigen
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP1R8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PPP1 R8 antibody was raised using a synthetic peptide corresponding to a region with amino acids DKLIEKLIIDEKKYYLFGRNPDLCDFTIDHQSCSRVHAALVYHKHLKRVF
- Top Product
- Discover our top product PPP1R8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP1R8 Blocking Peptide, catalog no. 33R-2025, is also available for use as a blocking control in assays to test for specificity of this PPP1R8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP1R8 (Protein Phosphatase 1, Regulatory Subunit 8 (PPP1R8))
- Andere Bezeichnung
- PPP1R8 (PPP1R8 Produkte)
- Synonyme
- ARD-1 antikoerper, ARD1 antikoerper, NIPP-1 antikoerper, NIPP1 antikoerper, PRO2047 antikoerper, 6330548N22Rik antikoerper, AU044684 antikoerper, PPP1R8 antikoerper, ard-1 antikoerper, ard1 antikoerper, nipp-1 antikoerper, nipp1 antikoerper, ppp1r8 antikoerper, si:ch211-206a7.1 antikoerper, protein phosphatase 1 regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8 antikoerper, protein phosphatase 1, regulatory (inhibitor) subunit 8 antikoerper, protein phosphatase 1, regulatory subunit 8b antikoerper, protein phosphatase 1 regulatory subunit 8 L homeolog antikoerper, protein phosphatase 1, regulatory subunit 8a antikoerper, protein phosphatase 1 regulatory subunit 8 S homeolog antikoerper, PPP1R8 antikoerper, Ppp1r8 antikoerper, ppp1r8b antikoerper, ppp1r8.L antikoerper, ppp1r8a antikoerper, ppp1r8.S antikoerper
- Hintergrund
- This gene, through alternative splicing, encodes three different isoforms. Two of the protein isoforms encoded by this gene are specific inhibitors of type 1 serine/threonine protein phosphatases and can bind but not cleave RNA. The third protein isoform lacks the phosphatase inhibitory function but is a single-strand endoribonuclease comparable to RNase E of E. coli. This isoform requires magnesium for its function and cleaves specific sites in A+U-rich regions of RNA.
- Molekulargewicht
- 38 kDa (MW of target protein)
-