-
- Target Alle DND1 Antikörper anzeigen
- DND1 (Dead End Homolog 1 (DND1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DND1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids HRFWYQVVIPGHPVPFSGLIWVVLTLDGRDGHEVAKDAVSVRLLQALSES
- Top Product
- Discover our top product DND1 Primärantikörper
-
anti-Dead End Homolog 1 (DND1) (AA 167-260) antibody
DND1 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 2G11 unconjugated
anti-Dead End Homolog 1 (DND1) (AA 167-260) antibodyDND1 Reaktivität: Human WB, ELISA, IF Wirt: Maus Monoclonal 3H5 unconjugated
anti-Dead End Homolog 1 (DND1) (C-Term) antibodyDND1 Reaktivität: Human, Ratte, Hund, Maus, Schwein, Kaninchen, Hamster WB, IHC (p), IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Dead End Homolog 1 (DND1) (AA 37-180) antibodyDND1 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Dead End Homolog 1 (DND1) (AA 41-90) antibodyDND1 Reaktivität: Human, Ratte, Hund, Schwein, Rind (Kuh), Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
anti-Dead End Homolog 1 (DND1) (C-Term) antibodyDND1 Reaktivität: Human, Ratte, Hund, Maus, Schwein, Rind (Kuh), Pferd, Meerschweinchen, Kaninchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DND1 Blocking Peptide, catalog no. 33R-3840, is also available for use as a blocking control in assays to test for specificity of this DND1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DND1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DND1 (Dead End Homolog 1 (DND1))
- Andere Bezeichnung
- DND1 (DND1 Produkte)
- Synonyme
- dnd antikoerper, xde antikoerper, Xdead antikoerper, rbms4 antikoerper, dead-end antikoerper, DND1 antikoerper, BC034897 antikoerper, RBMS4 antikoerper, Ter antikoerper, DND microRNA-mediated repression inhibitor 1 antikoerper, dead end protein homolog 1 pseudogene antikoerper, dnd1 antikoerper, LOC100349427 antikoerper, DND1 antikoerper, Dnd1 antikoerper
- Hintergrund
- DND1 contains 2 RRM (RNA recognition motif) domains. It may play a role during primordial germ cell (PGC) development. However, DND1 does not seem to be essential for PGC migration.
- Molekulargewicht
- 39 kDa (MW of target protein)
-
Sie sind hier:
