BCAS2 Antikörper (Middle Region)
-
- Target Alle BCAS2 Antikörper anzeigen
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BCAS2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BCAS2 antibody was raised against the middle region of BCAS2
- Aufreinigung
- Affinity purified
- Immunogen
- BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
- Top Product
- Discover our top product BCAS2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BCAS2 Blocking Peptide, catalog no. 33R-8559, is also available for use as a blocking control in assays to test for specificity of this BCAS2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCAS2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BCAS2 (Breast Carcinoma Amplified Sequence 2 (BCAS2))
- Andere Bezeichnung
- BCAS2 (BCAS2 Produkte)
- Synonyme
- DAM1 antikoerper, SPF27 antikoerper, Snt309 antikoerper, 6430539P16Rik antikoerper, AI132645 antikoerper, C76366 antikoerper, C80030 antikoerper, BCAS2 antikoerper, cb302 antikoerper, zgc:101730 antikoerper, BCAS2, pre-mRNA processing factor antikoerper, breast carcinoma amplified sequence 2 antikoerper, breast carcinoma amplified sequence 2 L homeolog antikoerper, BCAS2 antikoerper, Bcas2 antikoerper, bcas2 antikoerper, bcas2.L antikoerper, CpipJ_CPIJ003889 antikoerper
- Hintergrund
- BCAS2 belongs to the SPF27 family. It is involved in mRNA splicing. The protein might play an important role in breast cancer development by increasing the estrogen receptor's function.
- Molekulargewicht
- 26 kDa (MW of target protein)
-