ADAT1 Antikörper (C-Term)
-
- Target Alle ADAT1 Antikörper anzeigen
- ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ADAT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- ADAT1 antibody was raised against the C terminal of ADAT1
- Aufreinigung
- Affinity purified
- Immunogen
- ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids LFRSFQKLLSRIARDKWPHSLRVQKLDTYQEYKEAASSYQEAWSTLRKQV
- Top Product
- Discover our top product ADAT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ADAT1 Blocking Peptide, catalog no. 33R-4947, is also available for use as a blocking control in assays to test for specificity of this ADAT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ADAT1 (Adenosine Deaminase, tRNA-Specific 1 (ADAT1))
- Andere Bezeichnung
- ADAT1 (ADAT1 Produkte)
- Synonyme
- ADAT1 antikoerper, zgc:162299 antikoerper, HADAT1 antikoerper, MMADAT1 antikoerper, mADAT1 antikoerper, adenosine deaminase, tRNA specific 1 antikoerper, adenosine deaminase, tRNA-specific 1 antikoerper, ADAT1 antikoerper, adat1 antikoerper, Adat1 antikoerper
- Hintergrund
- ADAT1 is a member of the ADAR (adenosine deaminase acting on RNA) family. Using site-specific adenosine modification, the family participates in the pre-mRNA editing of nuclear transcripts. ADAT1, tRNA-specific adenosine deaminase 1, is responsible for the deamination of adenosine 37 to inosine in eukaryotic tRNA.
- Molekulargewicht
- 55 kDa (MW of target protein)
-