DDX24 Antikörper

Produktnummer ABIN633266

Produktdetails anti-DDX24 Antikörper

Target: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DDX24 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DDX24 Blocking Peptide, catalog no. 33R-2570, is also available for use as a blocking control in assays to test for specificity of this DDX24 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX24 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DDX24

Target: DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))

Andere Bezeichnung: DDX24 (DDX24 Produkte)

Synonyme: DDX24 antikoerper, DKFZp459P2030 antikoerper, 1700055J08Rik antikoerper, 2510027P10Rik antikoerper, AI649272 antikoerper, DEAD-box helicase 24 antikoerper, DEAD-box helicase 24 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 24 antikoerper, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 antikoerper, Ddx24 antikoerper, ddx24.L antikoerper, DDX24 antikoerper, ddx24 antikoerper, Chro.80030 antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.

Molekulargewicht: 96 kDa (MW of target protein)