DDX24 Antikörper
-
- Target Alle DDX24 Antikörper anzeigen
- DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DDX24 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- DDX24 antibody was raised using a synthetic peptide corresponding to a region with amino acids ELRHLLSQPLFTESQKTKYPTQSGKPPLLVSAPSKSESALSCLSKQKKKK
- Top Product
- Discover our top product DDX24 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DDX24 Blocking Peptide, catalog no. 33R-2570, is also available for use as a blocking control in assays to test for specificity of this DDX24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDX24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DDX24 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 24 (DDX24))
- Andere Bezeichnung
- DDX24 (DDX24 Produkte)
- Synonyme
- DDX24 antikoerper, DKFZp459P2030 antikoerper, 1700055J08Rik antikoerper, 2510027P10Rik antikoerper, AI649272 antikoerper, DEAD-box helicase 24 antikoerper, DEAD-box helicase 24 L homeolog antikoerper, DEAD (Asp-Glu-Ala-Asp) box helicase 24 antikoerper, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 24 antikoerper, DEAD (Asp-Glu-Ala-Asp) box polypeptide 24 antikoerper, Ddx24 antikoerper, ddx24.L antikoerper, DDX24 antikoerper, ddx24 antikoerper, Chro.80030 antikoerper
- Hintergrund
- DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation.
- Molekulargewicht
- 96 kDa (MW of target protein)
-