HNRNPUL1 Antikörper (Middle Region)
-
- Target Alle HNRNPUL1 Antikörper anzeigen
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPUL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HNRPUL1 antibody was raised against the middle region of Hnrpul1
- Aufreinigung
- Affinity purified
- Immunogen
- HNRPUL1 antibody was raised using the middle region of Hnrpul1 corresponding to a region with amino acids LPDVGDFLDEVLFIELQREEADKLVRQYNEEGRKAGPPPEKRFDNRGGGG
- Top Product
- Discover our top product HNRNPUL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPUL1 Blocking Peptide, catalog no. 33R-5262, is also available for use as a blocking control in assays to test for specificity of this HNRPUL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPUL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPUL1 (Heterogeneous Nuclear Ribonucleoprotein U-Like 1 (HNRNPUL1))
- Andere Bezeichnung
- HNRPUL1 (HNRNPUL1 Produkte)
- Synonyme
- HNRPUL1 antikoerper, E1B-AP5 antikoerper, E1BAP5 antikoerper, E130317O14Rik antikoerper, Hnrnpul antikoerper, Hnrpul1 antikoerper, hnrpul1 antikoerper, wu:fb53d10 antikoerper, wu:fk45c03 antikoerper, zgc:85971 antikoerper, heterogeneous nuclear ribonucleoprotein U like 1 antikoerper, coiled-coil domain containing 97 antikoerper, heterogeneous nuclear ribonucleoprotein U-like 1 antikoerper, HNRNPUL1 antikoerper, CCDC97 antikoerper, Desac_1308 antikoerper, Hnrnpul1 antikoerper, hnrnpul1 antikoerper
- Hintergrund
- HNRPUL1 is a nuclear RNA-binding protein of the heterogeneous nuclear ribonucleoprotein (hnRNP) family. This protein binds specifically to adenovirus E1B-55kDa oncoprotein. It may play an important role in nucleocytoplasmic RNA transport.
- Molekulargewicht
- 85 kDa (MW of target protein)
-