HNRNPL Antikörper (N-Term)
-
- Target Alle HNRNPL Antikörper anzeigen
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HNRNPL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- HNRPL antibody was raised against the N terminal of HNRPL
- Aufreinigung
- Affinity purified
- Immunogen
- HNRPL antibody was raised using the N terminal of HNRPL corresponding to a region with amino acids AAGGGGGGENYDDPHKTPASPVVHIRGLIDGVVEADLVEALQEFGPISYV
- Top Product
- Discover our top product HNRNPL Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HNRPL Blocking Peptide, catalog no. 33R-1021, is also available for use as a blocking control in assays to test for specificity of this HNRPL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HNRNPL (Heterogeneous Nuclear Ribonucleoprotein L (HNRNPL))
- Andere Bezeichnung
- HNRPL (HNRNPL Produkte)
- Synonyme
- HNRPL antikoerper, hnRNP-L antikoerper, zgc:55429 antikoerper, HNRNPL antikoerper, hnrpl antikoerper, C79783 antikoerper, D830027H13Rik antikoerper, Hnrpl antikoerper, hnrnp-L antikoerper, heterogeneous nuclear ribonucleoprotein L antikoerper, HNRNPL antikoerper, hnrpl antikoerper, hnrnpl antikoerper, Hnrnpl antikoerper
- Hintergrund
- Heterogeneous nuclear RNAs (hnRNAs) which include mRNA precursors and mature mRNAs are associated with specific proteins to form heterogenous ribonucleoprotein (hnRNP) complexes. Heterogeneous nuclear ribonucleoprotein L is among the proteins that are stably associated with hnRNP complexes and along with other hnRNP proteins is likely to play a major role in the formation, packaging, processing, and function of mRNA.
- Molekulargewicht
- 65 kDa (MW of target protein)
-