SIP1 Antikörper (Middle Region)
-
- Target Alle SIP1 (GEMIN2) Antikörper anzeigen
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SIP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SIP1 antibody was raised against the middle region of SIP1
- Aufreinigung
- Affinity purified
- Immunogen
- SIP1 antibody was raised using the middle region of SIP1 corresponding to a region with amino acids HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYFDQRDLADEPS
- Top Product
- Discover our top product GEMIN2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SIP1 Blocking Peptide, catalog no. 33R-3856, is also available for use as a blocking control in assays to test for specificity of this SIP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SIP1 (GEMIN2) (Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2))
- Andere Bezeichnung
- SIP1 (GEMIN2 Produkte)
- Synonyme
- SIP1 antikoerper, SIP1-delta antikoerper, 1700012N19Rik antikoerper, Sip1 antikoerper, sip1 antikoerper, sip1-delta antikoerper, wu:fc52a05 antikoerper, zgc:110274 antikoerper, gem nuclear organelle associated protein 2 antikoerper, gem (nuclear organelle) associated protein 2 antikoerper, gem nuclear organelle associated protein 2 S homeolog antikoerper, GEMIN2 antikoerper, Gemin2 antikoerper, gemin2.S antikoerper, gemin2 antikoerper
- Hintergrund
- Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
- Molekulargewicht
- 30 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Tube Formation
-