DAZL Antikörper (C-Term)

Produktnummer ABIN633244

Produktdetails anti-DAZL Antikörper

Target: DAZL (Deleted in Azoospermia-Like (DAZL))

Bindungsspezifität: C-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DAZL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DAZL antibody was raised against the C terminal of DAZL

Aufreinigung: Affinity purified

Immunogen: DAZL antibody was raised using the C terminal of DAZL corresponding to a region with amino acids EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DAZL Blocking Peptide, catalog no. 33R-2778, is also available for use as a blocking control in assays to test for specificity of this DAZL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DAZL

Target: DAZL (Deleted in Azoospermia-Like (DAZL))

Andere Bezeichnung: DAZL (DAZL Produkte)

Synonyme: DAZH antikoerper, DAZL1 antikoerper, DAZLA antikoerper, SPGYLA antikoerper, DAZL antikoerper, Xdazl antikoerper, dazh antikoerper, dazl1 antikoerper, dazla antikoerper, spgyla antikoerper, dazl-B antikoerper, dazl-a antikoerper, Daz-like antikoerper, Dazh antikoerper, Dazl1 antikoerper, Dazla antikoerper, Tpx-2 antikoerper, Tpx2 antikoerper, deleted in azoospermia like antikoerper, deleted in azoospermia-like antikoerper, deleted in azoospermia-like L homeolog antikoerper, DAZL antikoerper, dazl antikoerper, Dazl antikoerper, dazl.L antikoerper

Hintergrund: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females.

Molekulargewicht: 33 kDa (MW of target protein)