RBM39 Antikörper (Middle Region)
-
- Target Alle RBM39 Antikörper anzeigen
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RBM39 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RBM39 antibody was raised against the middle region of RBM39
- Aufreinigung
- Affinity purified
- Immunogen
- RBM39 antibody was raised using the middle region of RBM39 corresponding to a region with amino acids FRGRYRSPYSGPKFNSAIRGKIGLPHSIKLSRRRSRSKSPFRKDKSPVRE
- Top Product
- Discover our top product RBM39 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RBM39 Blocking Peptide, catalog no. 33R-3048, is also available for use as a blocking control in assays to test for specificity of this RBM39 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM39 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RBM39 (RNA Binding Motif Protein 39 (RBM39))
- Andere Bezeichnung
- RBM39 (RBM39 Produkte)
- Synonyme
- CAPER antikoerper, CAPERalpha antikoerper, FSAP59 antikoerper, HCC1 antikoerper, RNPC2 antikoerper, 1500012C14Rik antikoerper, 2310040E03Rik antikoerper, B330012G18Rik antikoerper, C79248 antikoerper, R75070 antikoerper, Rnpc2 antikoerper, caper antikoerper, RBM39 antikoerper, Rbm39 antikoerper, ACYPI002389 antikoerper, DKFZp459F148 antikoerper, rnpc2 antikoerper, zgc:55780 antikoerper, rnpc2l antikoerper, wu:fa97g07 antikoerper, wu:fb09c08 antikoerper, zgc:112139 antikoerper, zgc:113117 antikoerper, RNA binding motif protein 39 antikoerper, RNA binding motif protein 39a antikoerper, RNA binding motif protein 39 L homeolog antikoerper, RNA binding motif protein 39b antikoerper, RBM39 antikoerper, Rbm39 antikoerper, rbm39a antikoerper, rbm39.L antikoerper, rbm39b antikoerper
- Hintergrund
- RBM39 is an RNA binding protein and possible splicing factor. It is found in the nucleus, where it colocalizes with core spliceosomal proteins. Studies of a mouse protein with high sequence similarity to this protein suggest that this protein may act as a transcriptional coactivator for JUN/AP-1 and estrogen receptors.
- Molekulargewicht
- 20 kDa (MW of target protein)
-