CSTF2 Antikörper (N-Term)

Produktnummer ABIN633237

Produktdetails anti-CSTF2 Antikörper

Target: CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSTF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CSTF2 antibody was raised against the N terminal of CSTF2

Aufreinigung: Affinity purified

Immunogen: CSTF2 antibody was raised using the N terminal of CSTF2 corresponding to a region with amino acids VDPEIALKILHRQTNIPTLIAGNPQPVHGAGPGSGSNVSMNQQNPQAPQA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CSTF2 Blocking Peptide, catalog no. 33R-9471, is also available for use as a blocking control in assays to test for specificity of this CSTF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSTF2

Target: CSTF2 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 2, 64kDa (CSTF2))

Andere Bezeichnung: CSTF2 (CSTF2 Produkte)

Synonyme: CSTF2 antikoerper, CstF-64 antikoerper, fb11e07 antikoerper, zgc:56346 antikoerper, zgc:77730 antikoerper, wu:fb11e07 antikoerper, 64kDa antikoerper, C630034J23Rik antikoerper, Cstf64 antikoerper, CSFT64 antikoerper, cstF-64 antikoerper, cstf-64 antikoerper, cleavage stimulation factor subunit 2 antikoerper, cleavage stimulation factor, 3' pre-RNA, subunit 2 antikoerper, cleavage stimulation factor, 3' pre-RNA subunit 2 antikoerper, CSTF2 antikoerper, cstf2 antikoerper, Cstf2 antikoerper, cstf2.L antikoerper

Hintergrund: CSTF2 is a nuclear protein with an RRM (RNA recognition motif) domain. The protein is a member of the cleavage stimulation factor (CSTF) complex that is involved in the 3' end cleavage and polyadenylation of pre-mRNAs. Specifically, this protein binds GU-rich elements within the 3'-untranslated region of mRNAs.

Molekulargewicht: 61 kDa (MW of target protein)