HNRNPH1 Antikörper (Middle Region)

Produktnummer ABIN633236

Der Kaninchen Polyklonal anti-HNRNPH1 Antikörper wird verwendet zum Nachweis von HNRNPH1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für HNRNPH1 Antikörper (Middle Region) (ABIN633236)

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HNRNPH1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HNRPH1 antibody was raised against the middle region of Hnrph1

Aufreinigung: Affinity purified

Immunogen: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPH1 Blocking Peptide, (ABIN938361), is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPH1

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Andere Bezeichnung: HNRPH1

Hintergrund: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 49 kDa (MW of target protein)