HNRNPH1 Antikörper (Middle Region)

Produktnummer ABIN633236

Produktdetails anti-HNRNPH1 Antikörper

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HNRNPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HNRPH1 antibody was raised against the middle region of Hnrph1

Aufreinigung: Affinity purified

Immunogen: HNRPH1 antibody was raised using the middle region of Hnrph1 corresponding to a region with amino acids FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HNRPH1 Blocking Peptide, catalog no. 33R-2975, is also available for use as a blocking control in assays to test for specificity of this HNRPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HNRPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HNRNPH1

Target: HNRNPH1 (Heterogeneous Nuclear Ribonucleoprotein H1 (H) (HNRNPH1))

Andere Bezeichnung: HNRPH1 (HNRNPH1 Produkte)

Synonyme: HNRPH antikoerper, HNRPH1 antikoerper, hnRNPH antikoerper, HNRNPH1 antikoerper, hnrph antikoerper, hnrnph antikoerper, hnrph1 antikoerper, hnrnph2 antikoerper, MGC78776 antikoerper, hnrph2 antikoerper, MGC80081 antikoerper, MGC130700 antikoerper, MGC69543 antikoerper, AI642080 antikoerper, E430005G16Rik antikoerper, Hnrnph antikoerper, Hnrph1 antikoerper, Hnrph antikoerper, zgc:77712 antikoerper, heterogeneous nuclear ribonucleoprotein H1 antikoerper, heterogeneous nuclear ribonucleoprotein H2 antikoerper, heterogeneous nuclear ribonucleoprotein H1 S homeolog antikoerper, heterogeneous nuclear ribonucleoprotein H1 L homeolog antikoerper, HNRNPH1 antikoerper, HNRNPH2 antikoerper, hnrnph1.S antikoerper, hnrnph1.L antikoerper, hnrnph1 antikoerper, Hnrnph1 antikoerper

Hintergrund: HNRPH1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm.

Molekulargewicht: 49 kDa (MW of target protein)