DROSHA Antikörper (Middle Region)

Produktnummer ABIN633216

Produktdetails anti-DROSHA Antikörper

Target: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DROSHA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: RNASEN antibody was raised against the middle region of RNASEN

Aufreinigung: Affinity purified

Immunogen: RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

RNASEN Blocking Peptide, catalog no. 33R-1038, is also available for use as a blocking control in assays to test for specificity of this RNASEN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DROSHA

Target: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Andere Bezeichnung: RNASEN (DROSHA Produkte)

Synonyme: im:7150667 antikoerper, zgc:158612 antikoerper, ETOHI2 antikoerper, HSA242976 antikoerper, RANSE3L antikoerper, RN3 antikoerper, RNASE3L antikoerper, RNASEN antikoerper, 1110013A17Rik antikoerper, AI874853 antikoerper, Etohi2 antikoerper, Rn3 antikoerper, Rnasen antikoerper, RGD1307626 antikoerper, ribonuclease type III, nuclear antikoerper, Ribonuclease 3 antikoerper, ribonuclease 3 antikoerper, drosha ribonuclease III antikoerper, drosha, ribonuclease type III antikoerper, rnasen antikoerper, Thicy_0885 antikoerper, Sinme_0866 antikoerper, Isova_2087 antikoerper, Sphch_0770 antikoerper, DROSHA antikoerper, Drosha antikoerper

Hintergrund: RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus.

Molekulargewicht: 159 kDa (MW of target protein)

Pathways: Regulatorische RNA Pathways