RNP Antikörper
-
- Target Alle RNP (RNPC3) Antikörper anzeigen
- RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RNP Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- RNPC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA
- Top Product
- Discover our top product RNPC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RNPC3 Blocking Peptide, catalog no. 33R-5006, is also available for use as a blocking control in assays to test for specificity of this RNPC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNPC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RNP (RNPC3) (RNA-Binding Region (RNP1, RRM) Containing 3 (RNPC3))
- Andere Bezeichnung
- RNPC3 (RNPC3 Produkte)
- Synonyme
- rnp antikoerper, rbm40 antikoerper, zgc:136847 antikoerper, RBM40 antikoerper, RNP antikoerper, SNRNP65 antikoerper, 2810441O16Rik antikoerper, AI447568 antikoerper, C030014B17Rik antikoerper, RNA binding region (RNP1, RRM) containing 3 antikoerper, RNA-binding region (RNP1, RRM) containing 3 antikoerper, RNPC3 antikoerper, rnpc3 antikoerper, Rnpc3 antikoerper
- Hintergrund
- RNPC3 is an RNA-binding protein involved in pre-mRNA splicing. RNPC3 participates in pre-mRNA U12-dependent splicing. RNPC3 binds to the 3'-stem-loop of m7G-capped U12 snRNA.
- Molekulargewicht
- 58 kDa (MW of target protein)
-