Snurportin 1 Antikörper (Middle Region)
-
- Target Alle Snurportin 1 (SNUPN) Antikörper anzeigen
- Snurportin 1 (SNUPN)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Snurportin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SNUPN antibody was raised against the middle region of SNUPN
- Aufreinigung
- Affinity purified
- Immunogen
- SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL
- Top Product
- Discover our top product SNUPN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SNUPN Blocking Peptide, catalog no. 33R-3628, is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNUPN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Snurportin 1 (SNUPN)
- Andere Bezeichnung
- SNUPN (SNUPN Produkte)
- Synonyme
- rnut1 antikoerper, zgc:77819 antikoerper, wu:fc41a03 antikoerper, SNUPN antikoerper, kpnbl antikoerper, snurportin1 antikoerper, KPNBL antikoerper, RNUT1 antikoerper, Snurportin1 antikoerper, 0610031A09Rik antikoerper, Rnut1 antikoerper, Snupn1 antikoerper, snurportin 1 antikoerper, snupn antikoerper, SNUPN antikoerper, Snupn antikoerper
- Hintergrund
- The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, Protein targeting to Nucleus
-