Snurportin 1 Antikörper (Middle Region)

Produktnummer ABIN633209

Der Kaninchen Polyklonal anti-Snurportin 1 Antikörper wird verwendet zum Nachweis von Snurportin 1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für Snurportin 1 Antikörper (Middle Region) (ABIN633209)

Target: Snurportin 1 (SNUPN)

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Snurportin 1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-Snurportin 1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SNUPN antibody was raised against the middle region of SNUPN

Aufreinigung: Affinity purified

Immunogen: SNUPN antibody was raised using the middle region of SNUPN corresponding to a region with amino acids GVAVPAGPLTTKPDYAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SNUPN Blocking Peptide, (ABIN939014), is also available for use as a blocking control in assays to test for specificity of this SNUPN antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNUPN antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Snurportin 1

Target: Snurportin 1 (SNUPN)

Andere Bezeichnung: SNUPN

Hintergrund: The nuclear import of the spliceosomal snRNPs U1, U2, U4 and U5, is dependent on the presence of a complex nuclear localization signal. The latter is composed of the 5'-2,2,7-terminal trimethylguanosine (m3G) cap structure of the U snRNA and the Sm core domain. SNUPN interacts specifically with m3G-cap and functions as an snRNP-specific nuclear import receptor.

Molekulargewicht: 41 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization, Protein targeting to Nucleus