SKIV2L Antikörper

Produktnummer ABIN633197

Der Kaninchen Polyklonal anti-SKIV2L Antikörper wird verwendet zum Nachweis von SKIV2L in Proben von Human. Er wurde validiert für WB.

Kurzübersicht für SKIV2L Antikörper (ABIN633197)

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SKIV2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SKIV2L Antikörper

Aufreinigung: Affinity purified

Immunogen: SKIV2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SKIV2L Blocking Peptide, (ABIN5616164), is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SKIV2L

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Andere Bezeichnung: SKIV2L

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

Molekulargewicht: 138 kDa (MW of target protein)