SKIV2L Antikörper

Produktnummer ABIN633197

Produktdetails anti-SKIV2L Antikörper

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SKIV2L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SKIV2 L antibody was raised using a synthetic peptide corresponding to a region with amino acids SSNSTSRVFTTLVLCDKPLSQDPQDRGPATAEVPYPDDLVGFKLFLPEGP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SKIV2L Blocking Peptide, catalog no. 33R-8835, is also available for use as a blocking control in assays to test for specificity of this SKIV2L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SKIV0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SKIV2L

Target: SKIV2L (Superkiller Viralicidic Activity 2-Like (SKIV2L))

Andere Bezeichnung: SKIV2L (SKIV2L Produkte)

Synonyme: 4930534J06Rik antikoerper, AW214248 antikoerper, Ddx13 antikoerper, SKI antikoerper, Ski2w antikoerper, 170A antikoerper, DDX13 antikoerper, HLP antikoerper, SKI2 antikoerper, SKI2W antikoerper, SKIV2 antikoerper, THES2 antikoerper, superkiller viralicidic activity 2-like (S. cerevisiae) antikoerper, Ski2 like RNA helicase antikoerper, Skiv2l antikoerper, SKIV2L antikoerper

Hintergrund: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure.

Molekulargewicht: 138 kDa (MW of target protein)