PGBD3 Antikörper (N-Term)
-
- Target Alle PGBD3 Antikörper anzeigen
- PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PGBD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PGBD3 antibody was raised against the N terminal of PGBD3
- Aufreinigung
- Affinity purified
- Immunogen
- PGBD3 antibody was raised using the N terminal of PGBD3 corresponding to a region with amino acids AESDSDDPSYAPKDDSPDEVPSTFTVQQPPPSRRRKMTKILCKWKKADLT
- Top Product
- Discover our top product PGBD3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PGBD3 Blocking Peptide, catalog no. 33R-1149, is also available for use as a blocking control in assays to test for specificity of this PGBD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGBD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PGBD3 (PiggyBac Transposable Element Derived 3 (PGBD3))
- Andere Bezeichnung
- PGBD3 (PGBD3 Produkte)
- Synonyme
- PGBD3 antikoerper, piggyBac transposable element derived 3 antikoerper, ERCC excision repair 6, chromatin remodeling factor antikoerper, PGBD3 antikoerper, ERCC6 antikoerper
- Hintergrund
- The piggyBac family of proteins, found in diverse animals, are transposases related to the transposase of the canonical piggyBac transposon from the moth, Trichoplusia ni. This family also includes genes in several genomes, including human, that appear to have been derived from the piggyBac transposons. Anti-PGBD3 belongs to the subfamily of piggyBac transposable element derived (PGBD) genes. The PGBD proteins appear to be novel, with no obvious relationship to other transposases, or other known protein families. Anti-PGBD3 overlaps with the ERCC6 gene on chromosome 10, and pseudogenes of this locus have been found on chromosomes 4, 5 and 12.
- Molekulargewicht
- 67 kDa (MW of target protein)
- Pathways
- Chromatin Binding
-