RENT1/UPF1 Antikörper
-
- Target Alle RENT1/UPF1 (UPF1) Antikörper anzeigen
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser RENT1/UPF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG
- Top Product
- Discover our top product UPF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))
- Andere Bezeichnung
- UPF1 (UPF1 Produkte)
- Synonyme
- HUPF1 antikoerper, NORF1 antikoerper, RENT1 antikoerper, pNORF1 antikoerper, smg-2 antikoerper, B430202H16Rik antikoerper, PNORF-1 antikoerper, Rent1 antikoerper, Upflp antikoerper, rent1 antikoerper, wu:fi40f07 antikoerper, wu:fj48a01 antikoerper, zgc:55472 antikoerper, Tb05.3C6.50 antikoerper, AO090012000584 antikoerper, hupf1 antikoerper, norf1 antikoerper, pnorf1 antikoerper, upf1 antikoerper, UPF1, RNA helicase and ATPase antikoerper, UPF1 regulator of nonsense transcripts homolog (yeast) antikoerper, upf1 regulator of nonsense transcripts homolog (yeast) antikoerper, regulator of nonsense transcripts 1 antikoerper, Regulator of nonsense transcripts 1 antikoerper, UPF1 regulator of nonsense transcripts homolog S homeolog antikoerper, UPF1 antikoerper, Upf1 antikoerper, upf1 antikoerper, Tc00.1047053511317.30 antikoerper, Tb927.5.2140 antikoerper, TVAG_453890 antikoerper, TVAG_237840 antikoerper, AOR_1_1018194 antikoerper, HPB8_739 antikoerper, smg-2 antikoerper, upf1.S antikoerper
- Hintergrund
- UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.
- Molekulargewicht
- 123 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-