SFRS6 Antikörper (Middle Region)
-
- Target Alle SFRS6 (SRSF6) Antikörper anzeigen
- SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SFRS6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SFRS6 antibody was raised against the middle region of SFRS6
- Aufreinigung
- Affinity purified
- Immunogen
- SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS
- Top Product
- Discover our top product SRSF6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SFRS6 Blocking Peptide, catalog no. 33R-4356, is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))
- Andere Bezeichnung
- SFRS6 (SRSF6 Produkte)
- Synonyme
- B52 antikoerper, SFRS6 antikoerper, SRP55 antikoerper, 1210001E11Rik antikoerper, AI314910 antikoerper, AW146126 antikoerper, Sfrs6 antikoerper, b52 antikoerper, sfrs6 antikoerper, srp55 antikoerper, sfrs6b antikoerper, wu:faa54g02 antikoerper, wu:fc17h09 antikoerper, zgc:103497 antikoerper, fa12h12 antikoerper, sfrs6a antikoerper, wu:fa12h12 antikoerper, wu:fa13e06 antikoerper, zgc:63770 antikoerper, serine and arginine rich splicing factor 6 antikoerper, serine/arginine-rich splicing factor 6 antikoerper, serine/arginine-rich splicing factor 6 S homeolog antikoerper, serine/arginine-rich splicing factor 6b antikoerper, serine/arginine-rich splicing factor 6a antikoerper, SRSF6 antikoerper, Srsf6 antikoerper, srsf6.S antikoerper, srsf6b antikoerper, srsf6a antikoerper
- Hintergrund
- SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization
-