SFRS6 Antikörper (Middle Region)

Produktnummer ABIN633190

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch SFRS6 in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für SFRS6 Antikörper (Middle Region) (ABIN633190)

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SFRS6 Antikörper

Bindungsspezifität: Middle Region

Spezifität: SFRS6 antibody was raised against the middle region of SFRS6

Aufreinigung: Affinity purified

Immunogen: SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS6 Blocking Peptide, (ABIN939742), is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS6

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Andere Bezeichnung: SFRS6

Hintergrund: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization