SFRS6 Antikörper (Middle Region)

Produktnummer ABIN633190

Produktdetails anti-SFRS6 Antikörper

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SFRS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SFRS6 antibody was raised against the middle region of SFRS6

Aufreinigung: Affinity purified

Immunogen: SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SFRS6 Blocking Peptide, catalog no. 33R-4356, is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SFRS6

Target: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Andere Bezeichnung: SFRS6 (SRSF6 Produkte)

Synonyme: B52 antikoerper, SFRS6 antikoerper, SRP55 antikoerper, 1210001E11Rik antikoerper, AI314910 antikoerper, AW146126 antikoerper, Sfrs6 antikoerper, b52 antikoerper, sfrs6 antikoerper, srp55 antikoerper, sfrs6b antikoerper, wu:faa54g02 antikoerper, wu:fc17h09 antikoerper, zgc:103497 antikoerper, fa12h12 antikoerper, sfrs6a antikoerper, wu:fa12h12 antikoerper, wu:fa13e06 antikoerper, zgc:63770 antikoerper, serine and arginine rich splicing factor 6 antikoerper, serine/arginine-rich splicing factor 6 antikoerper, serine/arginine-rich splicing factor 6 S homeolog antikoerper, serine/arginine-rich splicing factor 6b antikoerper, serine/arginine-rich splicing factor 6a antikoerper, SRSF6 antikoerper, Srsf6 antikoerper, srsf6.S antikoerper, srsf6b antikoerper, srsf6a antikoerper

Hintergrund: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization