Retinoic Acid Receptor alpha Antikörper (N-Term)
-
- Target Alle Retinoic Acid Receptor alpha (RARA) Antikörper anzeigen
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Retinoic Acid Receptor alpha Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- RARA antibody was raised against the N terminal of RARA
- Aufreinigung
- Affinity purified
- Immunogen
- RARA antibody was raised using the N terminal of RARA corresponding to a region with amino acids YESVEVGGPTPNPFLVVDFYNQNRACLLPEKGLPAPGPYSTPLRTPLWNG
- Top Product
- Discover our top product RARA Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
RARA Blocking Peptide, catalog no. 33R-10090, is also available for use as a blocking control in assays to test for specificity of this RARA antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RARA antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Retinoic Acid Receptor alpha (RARA) (Retinoic Acid Receptor, alpha (RARA))
- Andere Bezeichnung
- RARA (RARA Produkte)
- Synonyme
- NR1B1 antikoerper, RAR antikoerper, Nr1b1 antikoerper, RARalpha1 antikoerper, rar-alpha antikoerper, etID309833.12 antikoerper, rara antikoerper, rara2a antikoerper, zRAR antikoerper, zRAR-alpha antikoerper, zgc:109797 antikoerper, nr1b1 antikoerper, RAR-ALPHA1 antikoerper, HS-RARa antikoerper, fj66e06 antikoerper, rara2b antikoerper, wu:fj66e06 antikoerper, retinoic acid receptor alpha antikoerper, retinoic acid receptor, alpha antikoerper, retinoic acid receptor, alpha a antikoerper, retinoic acid receptor alpha L homeolog antikoerper, retinoic acid receptor, alpha b antikoerper, RARA antikoerper, Rara antikoerper, LOC100136372 antikoerper, raraa antikoerper, rara.L antikoerper, rara antikoerper, rarab antikoerper
- Hintergrund
- Retinoid signaling is transduced by 2 families of nuclear receptors, retinoic acid receptor (RAR) and retinoid X receptor, which form RXR/RAR heterodimers. In the absence of ligand, DNA-bound RXR/RARA represses transcription by recruiting the corepressors NCOR1, SMRT, and histone deacetylase. When ligand binds to the complex, it induces a conformational change allowing the recruitment of coactivators, histone acetyltransferases, and the basic transcription machinery.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Nuclear Receptor Transcription Pathway, Retinoic Acid Receptor Signaling Pathway, Intracellular Steroid Hormone Receptor Signaling Pathway, Steroid Hormone Mediated Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, S100 Proteine
-