ANGPTL3 Antikörper (N-Term)

Produktnummer ABIN633180

Produktdetails anti-ANGPTL3 Antikörper

Target: ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ANGPTL3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ANGPTL3 antibody was raised against the N terminal of ANGPTL3

Aufreinigung: Affinity purified

Immunogen: ANGPTL3 antibody was raised using the N terminal of ANGPTL3 corresponding to a region with amino acids IFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ANGPTL3 Blocking Peptide, catalog no. 33R-3960, is also available for use as a blocking control in assays to test for specificity of this ANGPTL3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANGPTL3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ANGPTL3

Target: ANGPTL3 (Angiopoietin-Like 3 (ANGPTL3))

Andere Bezeichnung: ANGPTL3 (ANGPTL3 Produkte)

Synonyme: fb60e11 antikoerper, fb66h02 antikoerper, wu:fb60e11 antikoerper, wu:fb66h02 antikoerper, zgc:111943 antikoerper, ANGPTL3 antikoerper, LOC100230785 antikoerper, ANG-5 antikoerper, ANGPT5 antikoerper, ANL3 antikoerper, FHBL2 antikoerper, hypl antikoerper, angiopoietin-like 3 antikoerper, angiopoietin like 3 antikoerper, angptl3 antikoerper, ANGPTL3 antikoerper, Angptl3 antikoerper

Hintergrund: The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors.

Molekulargewicht: 51 kDa (MW of target protein)