OST alpha Antikörper (Middle Region)

Produktnummer ABIN633166

Produktdetails anti-OST alpha Antikörper

Target: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser OST alpha Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: OSTalpha antibody was raised against the middle region of OSTalpha

Aufreinigung: Affinity purified

Immunogen: OSTalpha antibody was raised using the middle region of OSTalpha corresponding to a region with amino acids LLMLGPFQYAFLKITLTLVGLFLVPDGIYDPADISEGSTALWINTFLGVS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

OSTalpha Blocking Peptide, catalog no. 33R-5169, is also available for use as a blocking control in assays to test for specificity of this OSTalpha antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OSTalpha antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu OST alpha

Target: OST alpha (OSTALPHA) (Organic Solute Transporter alpha (OSTALPHA))

Andere Bezeichnung: OSTalpha (OSTALPHA Produkte)

Synonyme: Osta antikoerper, Ostalpha antikoerper, RGD1311100 antikoerper, OSTA antikoerper, OSTalpha antikoerper, AV001382 antikoerper, AW261577 antikoerper, D630035O19Rik antikoerper, OSTALPHA antikoerper, solute carrier family 51, alpha subunit antikoerper, solute carrier family 51 alpha subunit antikoerper, Slc51a antikoerper, SLC51A antikoerper

Hintergrund: OSTalpha is essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood. OSTalpha efficiently transports the major species of bile acids.

Molekulargewicht: 38 kDa (MW of target protein)