HSD17B11 Antikörper
-
- Target Alle HSD17B11 Antikörper anzeigen
- HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSD17B11 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- HSD17 B11 antibody was raised using a synthetic peptide corresponding to a region with amino acids TGEIVLITGAGHGIGRLTAYEFAKLKSKLVLWDINKHGLEETAAKCKGLG
- Top Product
- Discover our top product HSD17B11 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSD17B11 Blocking Peptide, catalog no. 33R-9080, is also available for use as a blocking control in assays to test for specificity of this HSD17B11 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD10 11 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD17B11 (Hydroxysteroid (17-Beta) Dehydrogenase 11 (HSD17B11))
- Andere Bezeichnung
- HSD17B11 (HSD17B11 Produkte)
- Synonyme
- 17BHSD11 antikoerper, DHRS8 antikoerper, PAN1B antikoerper, RETSDR2 antikoerper, SDR16C2 antikoerper, Dhrs8 antikoerper, HSD17B13 antikoerper, MGC84756 antikoerper, HSD17B11 antikoerper, Pan1b antikoerper, SDR2 antikoerper, retSDR2 antikoerper, 17-beta-HSD 11 antikoerper, 17-beta-HSD XI antikoerper, 17bHSD11 antikoerper, 17betaHSD11 antikoerper, 17betaHSDXI antikoerper, hydroxysteroid 17-beta dehydrogenase 11 antikoerper, hydroxysteroid (17-beta) dehydrogenase 11 antikoerper, hydroxysteroid (17-beta) dehydrogenase 11 L homeolog antikoerper, estradiol 17-beta-dehydrogenase 11 antikoerper, HSD17B11 antikoerper, Hsd17b11 antikoerper, hsd17b11.L antikoerper, hsd17b11 antikoerper, LOC100348005 antikoerper, LOC100520923 antikoerper
- Hintergrund
- Short-chain alcohol dehydrogenases, such as HSD17B11, metabolize secondary alcohols and ketones.
- Molekulargewicht
- 33 kDa (MW of target protein)
-