ALDH1A1 Antikörper (Middle Region)

Produktnummer ABIN633157

Produktdetails anti-ALDH1A1 Antikörper

Target: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALDH1A1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ALDH1 A1 antibody was raised against the middle region of ALDH1 1

Aufreinigung: Affinity purified

Immunogen: ALDH1 A1 antibody was raised using the middle region of ALDH1 1 corresponding to a region with amino acids SVERAKKYILGNPLTPGVTQGPQIDKEQYDKILDLIESGKKEGAKLECGG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALDH1A1 Blocking Peptide, catalog no. 33R-8907, is also available for use as a blocking control in assays to test for specificity of this ALDH1A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALDH1A1

Target: ALDH1A1 (Aldehyde Dehydrogenase 1 Family, Member A1 (ALDH1A1))

Andere Bezeichnung: ALDH1A1 (ALDH1A1 Produkte)

Synonyme: ALDC antikoerper, ALDH-E1 antikoerper, ALDH1 antikoerper, ALDH11 antikoerper, PUMB1 antikoerper, RALDH1 antikoerper, AL1A1 antikoerper, aldc antikoerper, aldh-e1 antikoerper, aldh1 antikoerper, aldh11 antikoerper, pumb1 antikoerper, raldh1 antikoerper, GGADHR antikoerper, ALDH1A1 antikoerper, ALDDH antikoerper, Ahd2 antikoerper, Aldh1 antikoerper, Aldh2 antikoerper, Ahd-2 antikoerper, Aldh1a2 antikoerper, E1 antikoerper, Raldh1 antikoerper, Aldh1a1 antikoerper, ALHDII antikoerper, RALDH 1 antikoerper, RalDH1 antikoerper, aldehyde dehydrogenase 1 family member A1 antikoerper, aldehyde dehydrogenase 1 family, member A1 antikoerper, aldehyde dehydrogenase 1 family member A1 L homeolog antikoerper, aldehyde dehydrogenase family 1, subfamily A1 antikoerper, aldehyde dehydrogenase antikoerper, retinal dehydrogenase 1 antikoerper, ALDH1A1 antikoerper, aldh1a1 antikoerper, Aldh1a1 antikoerper, aldh1a1.L antikoerper, aldH1 antikoerper, LOC100732581 antikoerper, LOC101822890 antikoerper

Hintergrund: This protein belongs to the aldehyde dehydrogenases family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a cytosolic isoform, which has a high affinity for aldehydes.

Molekulargewicht: 55 kDa (MW of target protein)

Pathways: Dopaminergic Neurogenesis