ASZ1 Antikörper (Middle Region)

Produktnummer ABIN633152

Produktdetails anti-ASZ1 Antikörper

Target: ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ASZ1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ASZ1 antibody was raised against the middle region of ASZ1

Aufreinigung: Affinity purified

Immunogen: ASZ1 antibody was raised using the middle region of ASZ1 corresponding to a region with amino acids GKMPSEIAKRNKHHEIFNLLSFTLNPLEGKLQQLTKEDTICKILTTDSDR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ASZ1 Blocking Peptide, catalog no. 33R-3373, is also available for use as a blocking control in assays to test for specificity of this ASZ1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASZ1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ASZ1

Target: ASZ1 (Ankyrin Repeat, SAM and Basic Leucine Zipper Domain Containing 1 (ASZ1))

Andere Bezeichnung: ASZ1 (ASZ1 Produkte)

Synonyme: Gasz antikoerper, GASZ antikoerper, gasz antikoerper, MGC56332 antikoerper, zgc:56332 antikoerper, ALP1 antikoerper, ANKL1 antikoerper, C7orf7 antikoerper, CT1.19 antikoerper, Orf3 antikoerper, 4933400N19Rik antikoerper, ORF3 antikoerper, ankyrin repeat, SAM and basic leucine zipper domain containing 1 antikoerper, Asz1 antikoerper, ASZ1 antikoerper, asz1 antikoerper

Hintergrund: ASZ1 plays a central role during spermatogenesis by repressing transposable elements and prevent their mobilization, which is essential for the germline integrity.

Molekulargewicht: 53 kDa (MW of target protein)