UBXN10 Antikörper (Middle Region)

Produktnummer ABIN633121

Produktdetails anti-UBXN10 Antikörper

Target: UBXN10 (UBX Domain Protein 10 (UBXN10))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser UBXN10 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: UBXD3 antibody was raised against the middle region of UBXD3

Aufreinigung: Affinity purified

Immunogen: UBXD3 antibody was raised using the middle region of UBXD3 corresponding to a region with amino acids PYELPSSQKPGACAPKSPNQGASDEIPELQQQVPTGASSSLNKYPVLPSI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

UBXD3 Blocking Peptide, catalog no. 33R-7443, is also available for use as a blocking control in assays to test for specificity of this UBXD3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBXD3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu UBXN10

Target: UBXN10 (UBX Domain Protein 10 (UBXN10))

Andere Bezeichnung: UBXD3 (UBXN10 Produkte)

Synonyme: UBXD3 antikoerper, zgc:153648 antikoerper, 5730509E04Rik antikoerper, A830047D02 antikoerper, Ubxd3 antikoerper, UBX domain protein 10 antikoerper, UBX domain protein 10 L homeolog antikoerper, UBXN10 antikoerper, ubxn10 antikoerper, ubxn10.L antikoerper, Ubxn10 antikoerper

Hintergrund: The function of UBXD3 protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 31 kDa (MW of target protein)