PRSS3 Antikörper (N-Term)

Produktnummer ABIN633109

Produktdetails anti-PRSS3 Antikörper

Target: PRSS3 (Protease, serine, 3 (PRSS3))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRSS3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRSS3 antibody was raised against the N terminal of PRSS3

Aufreinigung: Affinity purified

Immunogen: PRSS3 antibody was raised using the N terminal of PRSS3 corresponding to a region with amino acids VAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRSS3 Blocking Peptide, catalog no. 33R-9443, is also available for use as a blocking control in assays to test for specificity of this PRSS3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRSS3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRSS3

Target: PRSS3 (Protease, serine, 3 (PRSS3))

Andere Bezeichnung: PRSS3 (PRSS3 Produkte)

Synonyme: MTG antikoerper, PRSS4 antikoerper, T9 antikoerper, TRY3 antikoerper, TRY4 antikoerper, Try3 antikoerper, Tb antikoerper, prss3 antikoerper, protease, serine 3 antikoerper, trypsin-3 antikoerper, protease, serine, 3 antikoerper, trypsin III antikoerper, protease, serine 3 L homeolog antikoerper, PRSS3 antikoerper, CpipJ_CPIJ016105 antikoerper, Prss3 antikoerper, trp-iii antikoerper, prss3.L antikoerper

Hintergrund: This gene encodes a trypsinogen, which is a member of the trypsin family of serine proteases. This enzyme is expressed in the brain and pancreas and is resistant to common trypsin inhibitors. It is active on peptide linkages involving the carboxyl group of lysine or arginine. This gene is localized to the locus of T cell receptor beta variable orphans on chromosome 9. Four transcript variants encoding different isoforms have been described for this gene.

Molekulargewicht: 33 kDa (MW of target protein)