STK38L Antikörper (Middle Region)

Produktnummer ABIN633103

Produktdetails anti-STK38L Antikörper

Target: STK38L (serine/threonine Kinase 38 Like (STK38L))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STK38L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STK38 L antibody was raised against the middle region of STK38

Aufreinigung: Affinity purified

Immunogen: STK38 L antibody was raised using the middle region of STK38 corresponding to a region with amino acids PAAIPIEIKSIDDTSNFDDFPESDILQPVPNTTEPDYKSKDWVFLNYTYK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STK38L Blocking Peptide, catalog no. 33R-6952, is also available for use as a blocking control in assays to test for specificity of this STK38L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STK30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STK38L

Target: STK38L (serine/threonine Kinase 38 Like (STK38L))

Andere Bezeichnung: STK38L (STK38L Produkte)

Synonyme: RGD1564793 antikoerper, NDR2 antikoerper, 4930473A22Rik antikoerper, B230328I19 antikoerper, Ndr2 antikoerper, Ndr54 antikoerper, serine/threonine kinase 38 like antikoerper, Stk38l antikoerper, STK38L antikoerper

Hintergrund: STK38L is involved in the regulation of structural processes in differentiating and mature neuronal cells.

Molekulargewicht: 54 kDa (MW of target protein)