CFDP1 Antikörper (Middle Region)
-
- Target Alle CFDP1 Antikörper anzeigen
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CFDP1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CFDP1 antibody was raised against the middle region of CFDP1
- Aufreinigung
- Affinity purified
- Immunogen
- CFDP1 antibody was raised using the middle region of CFDP1 corresponding to a region with amino acids GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH
- Top Product
- Discover our top product CFDP1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CFDP1 Blocking Peptide, catalog no. 33R-3561, is also available for use as a blocking control in assays to test for specificity of this CFDP1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CFDP1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CFDP1 (Craniofacial Development Protein 1 (CFDP1))
- Andere Bezeichnung
- CFDP1 (CFDP1 Produkte)
- Synonyme
- CFDP1 antikoerper, cfdp1 antikoerper, fi15f05 antikoerper, MGC136405 antikoerper, wu:fi15f05 antikoerper, zgc:136405 antikoerper, BCNT antikoerper, BUCENTAUR antikoerper, CENP-29 antikoerper, CP27 antikoerper, SWC5 antikoerper, Yeti antikoerper, p97 antikoerper, AA408409 antikoerper, Bcnt antikoerper, Bucentaur antikoerper, Cfdp antikoerper, cp27 antikoerper, bcnt antikoerper, P97 antikoerper, craniofacial development protein 1 antikoerper, CFDP1 antikoerper, cfdp1 antikoerper, CpipJ_CPIJ018830 antikoerper, LOC100282347 antikoerper, Cfdp1 antikoerper
- Hintergrund
- CFDP1 may play a role during embryogenesis.
- Molekulargewicht
- 33 kDa (MW of target protein)
-