NAP1L2 Antikörper (Middle Region)

Produktnummer ABIN633097

Produktdetails anti-NAP1L2 Antikörper

Target: NAP1L2 (Nucleosome Assembly Protein 1-Like 2 (NAP1L2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NAP1L2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NAP1 L2 antibody was raised against the middle region of NAP1 2

Aufreinigung: Affinity purified

Immunogen: NAP1 L2 antibody was raised using the middle region of NAP1 2 corresponding to a region with amino acids VDTLTPLIKKYDEPILKLLTDIKVKLSDPGEPLSFTLEFHFKPNEYFKNE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NAP1L2 Blocking Peptide, catalog no. 33R-9481, is also available for use as a blocking control in assays to test for specificity of this NAP1L2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAP0 2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NAP1L2

Target: NAP1L2 (Nucleosome Assembly Protein 1-Like 2 (NAP1L2))

Andere Bezeichnung: NAP1L2 (NAP1L2 Produkte)

Synonyme: BPX antikoerper, Bpx antikoerper, nucleosome assembly protein 1 like 2 antikoerper, nucleosome assembly protein 1-like 2 antikoerper, NAP1L2 antikoerper, Nap1l2 antikoerper

Hintergrund: This gene encodes a member of the nucleosome assembly protein (NAP) family. The function of this family member is unknown, however, mouse studies suggest that it represents a class of tissue-specific factors interacting with chromatin to regulate neuronal cell proliferation.

Molekulargewicht: 52 kDa (MW of target protein)