FTO Antikörper (Middle Region)
-
- Target Alle FTO Antikörper anzeigen
- FTO (Fat Mass and Obesity-Associated (FTO))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FTO Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FTO antibody was raised against the middle region of FTO
- Aufreinigung
- Affinity purified
- Immunogen
- FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTA
- Top Product
- Discover our top product FTO Primärantikörper
-
anti-Fat Mass and Obesity-Associated (FTO) antibody
FTO Reaktivität: Human WB, ELISA, IHC, IF Wirt: Kaninchen Monoclonal 4G9 unconjugated Recombinant Antibody
anti-Fat Mass and Obesity-Associated (FTO) (AA 1-30), (N-Term) antibodyFTO Reaktivität: Human WB, IHC (p), FACS Wirt: Kaninchen Polyclonal RB21572 unconjugated
anti-Fat Mass and Obesity-Associated (FTO) antibodyFTO Reaktivität: Human WB, ELISA, IHC, IP Wirt: Maus Monoclonal AG103 unconjugated
anti-Fat Mass and Obesity-Associated (FTO) antibodyFTO Reaktivität: Maus WB, ELISA, IHC, IP Wirt: Maus Monoclonal FT62-6 unconjugated
anti-Fat Mass and Obesity-Associated (FTO) antibodyFTO Reaktivität: Maus WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Fat Mass and Obesity-Associated (FTO) antibodyFTO Reaktivität: Human, Maus, Ratte WB, ELISA, IP Wirt: Maus Monoclonal FT86-4 unconjugated
anti-Fat Mass and Obesity-Associated (FTO) (N-Term) antibodyFTO Reaktivität: Human, Maus, Ratte, Schwein, Rind (Kuh), Schaf, Pferd, Affe, Hamster WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Fat Mass and Obesity-Associated (FTO) (N-Term) antibodyFTO Reaktivität: Human WB, IF Wirt: Maus Monoclonal 5-2H10 unconjugated
anti-Fat Mass and Obesity-Associated (FTO) (AA 416-505) antibodyFTO Reaktivität: Human WB, IP Wirt: Kaninchen Polyclonal unconjugated
anti-Fat Mass and Obesity-Associated (FTO) antibodyFTO Reaktivität: Human, Maus, Ratte, Hund, Rind (Kuh), Schaf, Pferd, Primate WB, IHC, IHC (p), IF Wirt: Maus Monoclonal 5-2H10 unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FTO Blocking Peptide, catalog no. 33R-10037, is also available for use as a blocking control in assays to test for specificity of this FTO antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTO antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FTO (Fat Mass and Obesity-Associated (FTO))
- Andere Bezeichnung
- FTO (FTO Produkte)
- Synonyme
- AW743446 antikoerper, mKIAA1752 antikoerper, RGD1305121 antikoerper, FTO, alpha-ketoglutarate dependent dioxygenase antikoerper, fat mass and obesity associated antikoerper, fat mass and obesity associated L homeolog antikoerper, FTO antikoerper, Fto antikoerper, fto.L antikoerper
- Hintergrund
- The exact function of this gene is not known. Studies in mice suggest that it may be involved in nucleic acid demethylation, and that its mRNA level is regulated by feeding and fasting. Genomewide association studies of type 2 diabetes indicate this gene as a diabetes susceptibility locus. Mutation in this gene has been associated with growth retardation, developmental delay, coarse facies, and early death.
- Molekulargewicht
- 58 kDa (MW of target protein)
-
