IFN beta 1 (Middle Region) Antikörper

Produktnummer ABIN633094

Produktdetails

Target: IFN beta 1

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Applikation: Western Blotting (WB)

Spezifität: IFN Beta 1 antibody was raised against the middle region of IFNB1

Aufreinigung: Affinity purified

Immunogen: IFN Beta 1 antibody was raised using the middle region of IFNB1 corresponding to a region with amino acids NLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IFN Beta 1 Blocking Peptide, catalog no. 33R-6764, is also available for use as a blocking control in assays to test for specificity of this IFN Beta 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IFNB1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Referenzen

Matsumoto, Takahashi, Shiva, Kawanishi, Kremenik, Kato, Yano: "The reduction of voluntary physical activity after poly I:C injection is independent of the effect of poly I:C-induced interferon-beta in mice." in: Physiology & behavior, Vol. 93, Issue 4-5, pp. 835-41, (2008) (PubMed).

Antigendetails

Target: IFN beta 1

Hintergrund: IFNB1 has antiviral, antibacterial and anticancer activities.

Molekulargewicht: 22 kDa (MW of target protein)