ATP8B2 Antikörper (N-Term)
-
- Target Alle ATP8B2 Antikörper anzeigen
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATP8B2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- ATP8 B2 antibody was raised against the N terminal of ATP8 2
- Aufreinigung
- Affinity purified
- Immunogen
- ATP8 B2 antibody was raised using the N terminal of ATP8 2 corresponding to a region with amino acids MAVCAKKRPPEEERRARANDREYNEKFQYASNCIKTSKYNILTFLPVNLF
- Top Product
- Discover our top product ATP8B2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATP8B2 Blocking Peptide, catalog no. 33R-5795, is also available for use as a blocking control in assays to test for specificity of this ATP8B2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATP8B2 (ATPase, Aminophospholipid Transporter, Class I, Type 8B, Member 2 (ATP8B2))
- Andere Bezeichnung
- ATP8B2 (ATP8B2 Produkte)
- Synonyme
- Id antikoerper, ATPID antikoerper, fc09b04 antikoerper, wu:fc09b04 antikoerper, ATPase, class I, type 8B, member 2 antikoerper, ATPase phospholipid transporting 8B2 antikoerper, ATPase, aminophospholipid transporter, class I, type 8B, member 2 antikoerper, Atp8b2 antikoerper, ATP8B2 antikoerper, atp8b2 antikoerper
- Hintergrund
- The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of aminophospholipid-transporting ATPases. The aminophospholipid translocases transport phosphatidylserine and phosphatidylethanolamine from one side of a bilayer to another. Alternatively spliced transcript variants encoding different isoforms have been identified.
- Molekulargewicht
- 44 kDa (MW of target protein)
-