MITD1 Antikörper (Middle Region)
-
- Target Alle MITD1 Antikörper anzeigen
- MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MITD1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MITD1 antibody was raised against the middle region of MITD1
- Aufreinigung
- Affinity purified
- Immunogen
- MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDF
- Top Product
- Discover our top product MITD1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MITD1 Blocking Peptide, catalog no. 33R-8509, is also available for use as a blocking control in assays to test for specificity of this MITD1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MITD1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MITD1 (MIT, Microtubule Interacting and Transport, Domain Containing 1 (MITD1))
- Andere Bezeichnung
- MITD1 (MITD1 Produkte)
- Synonyme
- zgc:56159 antikoerper, MGC88990 antikoerper, MGC128843 antikoerper, MGC115722 antikoerper, 1500032H18Rik antikoerper, RGD1307700 antikoerper, MIT, microtubule interacting and transport, domain containing 1 antikoerper, microtubule interacting and trafficking domain containing 1 antikoerper, microtubule interacting and trafficking domain containing 1 L homeolog antikoerper, mitd1 antikoerper, MITD1 antikoerper, mitd1.L antikoerper, Mitd1 antikoerper
- Hintergrund
- MITD1 may play a role in endosomal protein transport.
- Molekulargewicht
- 29 kDa (MW of target protein)
-