WIPF2 Antikörper (Middle Region)

Produktnummer ABIN633078

Produktdetails anti-WIPF2 Antikörper

Target: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser WIPF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: WIPF2 antibody was raised against the middle region of WIPF2

Aufreinigung: Affinity purified

Immunogen: WIPF2 antibody was raised using the middle region of WIPF2 corresponding to a region with amino acids AAPPPPPPVIRNGARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

WIPF2 Blocking Peptide, catalog no. 33R-1041, is also available for use as a blocking control in assays to test for specificity of this WIPF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WIPF2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu WIPF2

Target: WIPF2 (WAS/WASL Interacting Protein Family, Member 2 (WIPF2))

Andere Bezeichnung: WIPF2 (WIPF2 Produkte)

Synonyme: wich antikoerper, wire antikoerper, MGC86383 antikoerper, wip/cr16 antikoerper, WICH antikoerper, WIRE antikoerper, 1110014J05Rik antikoerper, 5730509C05Rik antikoerper, AA407487 antikoerper, Gm1176 antikoerper, Wich antikoerper, Wire antikoerper, RGD1561080 antikoerper, WAS/WASL interacting protein family member 2 antikoerper, WAS/WASL interacting protein family member 2 S homeolog antikoerper, WAS/WASL interacting protein family, member 2 antikoerper, WIPF2 antikoerper, wipf2.S antikoerper, Wipf2 antikoerper

Hintergrund: This gene encodes a WASP interacting protein (WIP)-related protein. It has been shown that this protein has a role in the WASP-mediated organization of the actin cytoskeleton and that this protein is a potential link between the activated platelet-derived growth factor receptor and the actin polymerization machinery.

Molekulargewicht: 46 kDa (MW of target protein)