PIGL Antikörper (N-Term)

Produktnummer ABIN633056

Produktdetails anti-PIGL Antikörper

Target: PIGL (Phosphatidylinositol Glycan L (PIGL))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIGL Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PIGL antibody was raised against the N terminal of PIGL

Aufreinigung: Affinity purified

Immunogen: PIGL antibody was raised using the N terminal of PIGL corresponding to a region with amino acids MEAMWLLCVALAVLAWGFLWVWDSSERMKSREQGGRLGAESRTLLVIAHP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIGL Blocking Peptide, catalog no. 33R-5892, is also available for use as a blocking control in assays to test for specificity of this PIGL antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGL antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIGL

Target: PIGL (Phosphatidylinositol Glycan L (PIGL))

Andere Bezeichnung: PIGL (PIGL Produkte)

Synonyme: CHIME antikoerper, Gm737 antikoerper, phosphatidylinositol glycan anchor biosynthesis class L antikoerper, phosphatidylinositol glycan anchor biosynthesis, class L antikoerper, PIGL antikoerper, Pigl antikoerper

Hintergrund: This gene encodes an enzyme that catalyzes the second step of glycosylphosphatidylinositol (GPI) biosynthesis, which is the de-N-acetylation of N-acetylglucosaminylphosphatidylinositol (GlcNAc-PI). Study of a similar rat enzyme suggests that this protein localizes to the endoplasmic reticulum.

Molekulargewicht: 28 kDa (MW of target protein)

Pathways: Inositol Metabolic Process