PLEKHO1 Antikörper (N-Term)

Produktnummer ABIN633055

Produktdetails anti-PLEKHO1 Antikörper

Target: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PLEKHO1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PLEKHO1 antibody was raised against the N terminal of PLEKHO1

Aufreinigung: Affinity purified

Immunogen: PLEKHO1 antibody was raised using the N terminal of PLEKHO1 corresponding to a region with amino acids MMKKNNSAKRGPQDGNQQPAPPEKVGWVRKFCGKGIFREIWKNRYVVLKG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PLEKHO1 Blocking Peptide, catalog no. 33R-6233, is also available for use as a blocking control in assays to test for specificity of this PLEKHO1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLEKHO1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PLEKHO1

Target: PLEKHO1 (Pleckstrin Homology Domain Containing, Family O Member 1 (PLEKHO1))

Andere Bezeichnung: PLEKHO1 (PLEKHO1 Produkte)

Synonyme: CKIP-1 antikoerper, OC120 antikoerper, 2810052M02Rik antikoerper, Ckip1 antikoerper, JZA-20 antikoerper, Jza2 antikoerper, RGD1311487 antikoerper, ckip-1 antikoerper, plekho1 antikoerper, si:dkey-200h23.2 antikoerper, pleckstrin homology domain containing O1 antikoerper, pleckstrin homology domain containing, family O member 1 antikoerper, pleckstrin homology domain containing, family O member 1a antikoerper, PLEKHO1 antikoerper, Plekho1 antikoerper, plekho1a antikoerper

Hintergrund: PLEKHO1 plays a role in the regulation of the actin cytoskeleton through its interactions with actin capping protein (CP).PLEKHO1 may function to target CK2 to the plasma membrane thereby serving as an adapter to facilitate the phosphorylation of CP by protein kinase 2 (CK2). PLEKHO1 appears to target ATM to the plasma membrane. PLEKHO1 appears to also inhibit tumor cell growth by inhibiting AKT-mediated cell-survival. PLEKHO1 is also implicated in PI3K-regulated muscle differentiation, the regulation of AP-1 activity (plasma membrane bound AP-1 regulator that translocates to the nucleus) and the promotion of apoptosis induced by tumor necrosis factor TNF. When bound to PKB, it inhibits it probably by decreasing PKB level of phosphorylation.

Molekulargewicht: 46 kDa (MW of target protein)