AS3MT Antikörper

Produktnummer ABIN633047

Produktdetails anti-AS3MT Antikörper

Target: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser AS3MT Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: AS3 MT antibody was raised using a synthetic peptide corresponding to a region with amino acids GIKNESHDIVVSNCVINLVPDKQQVLQEAYRVLKHGGELYFSDVYTSLEL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AS3MT Blocking Peptide, catalog no. 33R-3331, is also available for use as a blocking control in assays to test for specificity of this AS3MT antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AS0 T antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu AS3MT

Target: AS3MT (Arsenic (+3 Oxidation State) Methyltransferase (AS3MT))

Andere Bezeichnung: AS3MT (AS3MT Produkte)

Synonyme: CYT19 antikoerper, 2310045H08Rik antikoerper, Cyt19 antikoerper, AS3MT antikoerper, zgc:136933 antikoerper, DKFZp469A1918 antikoerper, cyt19 antikoerper, arsenite methyltransferase antikoerper, arsenic (+3 oxidation state) methyltransferase antikoerper, BLOC-1 related complex subunit 7 antikoerper, arsenite methyltransferase, gene 1 antikoerper, AS3MT antikoerper, As3mt antikoerper, as3mt antikoerper, BORCS7 antikoerper, as3mt.1 antikoerper, ABO_2182 antikoerper

Hintergrund: AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.

Molekulargewicht: 42 kDa (MW of target protein)