NXPH3 Antikörper (N-Term)
-
- Target Alle NXPH3 Antikörper anzeigen
- NXPH3 (Neurexophilin 3 (NXPH3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NXPH3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Neurexophilin 3 antibody was raised against the N terminal of NXPH3
- Aufreinigung
- Affinity purified
- Immunogen
- Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN
- Top Product
- Discover our top product NXPH3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Neurexophilin 3 Blocking Peptide, catalog no. 33R-7840, is also available for use as a blocking control in assays to test for specificity of this Neurexophilin 3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NXPH3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NXPH3 (Neurexophilin 3 (NXPH3))
- Andere Bezeichnung
- Neurexophilin 3 (NXPH3 Produkte)
- Synonyme
- NPH3 antikoerper, Nph3 antikoerper, neurexophilin 3 antikoerper, neurexophilin 3 S homeolog antikoerper, NXPH3 antikoerper, nxph3.S antikoerper, nxph3 antikoerper, Nxph3 antikoerper
- Hintergrund
- NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
- Molekulargewicht
- 28 kDa (MW of target protein)
-