MRPS6 Antikörper (Middle Region)

Produktnummer ABIN633030

Produktdetails anti-MRPS6 Antikörper

Target: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MRPS6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MRPS6 antibody was raised against the middle region of MRPS6

Aufreinigung: Affinity purified

Immunogen: MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MRPS6 Blocking Peptide, catalog no. 33R-9511, is also available for use as a blocking control in assays to test for specificity of this MRPS6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPS6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MRPS6

Target: MRPS6 (Mitochondrial Ribosomal Protein S6 (MRPS6))

Andere Bezeichnung: MRPS6 (MRPS6 Produkte)

Synonyme: C21orf101 antikoerper, MRP-S6 antikoerper, RPMS6 antikoerper, S6mt antikoerper, AW046321 antikoerper, BcDNA:RH10862 antikoerper, CG15016 antikoerper, Dmel\\CG15016 antikoerper, Mrps6 antikoerper, zgc:153390 antikoerper, mitochondrial ribosomal protein S6 antikoerper, MRPS6 antikoerper, Mrps6 antikoerper, mRpS6 antikoerper, mrps6 antikoerper

Hintergrund: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology.

Molekulargewicht: 14 kDa (MW of target protein)