PCGF1 Antikörper (Middle Region)
-
- Target Alle PCGF1 Antikörper anzeigen
- PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PCGF1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PCGF1 antibody was raised against the middle region of PCGF1
- Aufreinigung
- Affinity purified
- Immunogen
- PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV
- Top Product
- Discover our top product PCGF1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PCGF1 Blocking Peptide, catalog no. 33R-6967, is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))
- Andere Bezeichnung
- PCGF1 (PCGF1 Produkte)
- Synonyme
- PCGF1 antikoerper, 2010002K04Rik antikoerper, NSPC1 antikoerper, RNF3A-2 antikoerper, RNF68 antikoerper, AU024121 antikoerper, Nspc1 antikoerper, nspc1 antikoerper, si:zc207o21.2 antikoerper, polycomb group ring finger 1 antikoerper, polycomb group ring finger 1 L homeolog antikoerper, PCGF1 antikoerper, pcgf1 antikoerper, Pcgf1 antikoerper, pcgf1.L antikoerper
- Hintergrund
- PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.
- Molekulargewicht
- 30 kDa (MW of target protein)
-