PCGF1 Antikörper (Middle Region)

Produktnummer ABIN633027

Der Kaninchen Polyklonal anti-PCGF1 Antikörper (ABIN633027) detektiert spezifisch PCGF1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für PCGF1 Antikörper (Middle Region) (ABIN633027)

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PCGF1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-PCGF1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: PCGF1 antibody was raised against the middle region of PCGF1

Aufreinigung: Affinity purified

Immunogen: PCGF1 antibody was raised using the middle region of PCGF1 corresponding to a region with amino acids PALSNLGLPFSSFDHSKAHYYRYDEQLNLCLERLSSGKDKNKSVLQNKYV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PCGF1 Blocking Peptide, (ABIN5615254), is also available for use as a blocking control in assays to test for specificity of this PCGF1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCGF1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PCGF1

Target: PCGF1 (Polycomb Group Ring Finger 1 (PCGF1))

Andere Bezeichnung: PCGF1

Hintergrund: PCGF1 is a mammalian homolog of the Drosophila polycomb group genes, which act as transcriptional repressors to regulate anterior-posterior patterning in early embryonic development.

Molekulargewicht: 30 kDa (MW of target protein)