MARK3 Antikörper (Middle Region)

Produktnummer ABIN633022

Produktdetails anti-MARK3 Antikörper

Target: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MARK3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MARK3 antibody was raised against the middle region of MARK3

Aufreinigung: Affinity purified

Immunogen: MARK3 antibody was raised using the middle region of MARK3 corresponding to a region with amino acids ATYNGPPASPSLSHEATPLSQTRSRGSTNLFSKLTSKLTRSRNVSAEQKD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MARK3 Blocking Peptide, catalog no. 33R-1579, is also available for use as a blocking control in assays to test for specificity of this MARK3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARK3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MARK3

Target: MARK3 (MAP/microtubule Affinity-Regulating Kinase 3 (MARK3))

Andere Bezeichnung: MARK3 (MARK3 Produkte)

Synonyme: MARK3 antikoerper, par1 antikoerper, par-1 antikoerper, Par-1A antikoerper, CTAK1 antikoerper, KP78 antikoerper, PAR1A antikoerper, Par-1a antikoerper, 1600015G02Rik antikoerper, A430080F22Rik antikoerper, C-TAK1 antikoerper, ETK-1 antikoerper, ETK1 antikoerper, Emk2 antikoerper, MPK10 antikoerper, fi39g08 antikoerper, wu:fi39g08 antikoerper, zgc:152848 antikoerper, zgc:55693 antikoerper, c-tak1 antikoerper, ctak1 antikoerper, emk-2 antikoerper, microtubule affinity regulating kinase 3 antikoerper, MAP/microtubule affinity-regulating kinase 3b antikoerper, MAP/microtubule affinity regulating kinase 3 antikoerper, MAP/microtubule affinity-regulating kinase 3a antikoerper, microtubule affinity regulating kinase 3 L homeolog antikoerper, MARK3 antikoerper, mark3b antikoerper, mark3 antikoerper, Mark3 antikoerper, mark3a antikoerper, mark3.L antikoerper

Hintergrund: MARK3 is involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.

Molekulargewicht: 81 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom